PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00217
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family BES1
Protein Properties Length: 349aa    MW: 38133.4 Da    PI: 9.3381
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00217genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822156.32.1e-481689275
      DUF822  2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskp 75
                +++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk++DnneVlkALc+eAGwvve+DGttyrk  ++
  AA39G00217 16 AARRKPSWRERENNRRRERRRRAVAAKIYSGLRAQGNYNLPKHCDNNEVLKALCAEAGWVVEEDGTTYRKVNSH 89
                689******************************************************************98776 PP

2DUF82233.91.1e-1010717471141
      DUF822  71 kgskpleeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasaasllpvls 141
                 +gskp+++ ++ag+s++++p ss ++s+ ss+++sp++sy+ sp+sssfpsps+ d  +++   +++p+l+
  AA39G00217 107 EGSKPPSSFDMAGTSSRVTPYSSHNQSPLSSTFESPIPSYQVSPSSSSFPSPSRGDPHNIS---TIFPFLR 174
                 5899999*************************************************99996...5666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.2E-5917164IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MTSDGATSTS AAAAMAARRK PSWRERENNR RRERRRRAVA AKIYSGLRAQ GNYNLPKHCD  60
NNEVLKALCA EAGWVVEEDG TTYRKVNSHA LALDLMLFVD VLAVGSEGSK PPSSFDMAGT  120
SSRVTPYSSH NQSPLSSTFE SPIPSYQVSP SSSSFPSPSR GDPHNISTIF PFLRSGIPSS  180
LPPLRISNSA PVTPPVSSPT SKNPKPLPTW ESFTKQSMTI AKQSMNSFNY PFYAVSAPAS  240
PTHRQFHAPA TIPECDESDS STVDSGHWIS FQKFSQQPFH GSGVPTSPTF NLVKPAPQQL  300
SRNTATQEIG QSSEFKFENS QVKPWEGERI HDVGMEDLEL TLGNSKARS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11736RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00073ChIP-chipTransfer from AT1G19350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0258081e-177AC025808.8 Genomic sequence for Arabidopsis thaliana BAC F18O14 from chromosome I, complete sequence.
GenBankAY0650411e-177AY065041.1 Arabidopsis thaliana At1g19350/F18O14_4 mRNA, complete cds.
GenBankCP0026841e-177CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010459601.11e-174PREDICTED: protein BRASSINAZOLE-RESISTANT 2
RefseqXP_010459602.11e-174PREDICTED: protein BRASSINAZOLE-RESISTANT 2
SwissprotQ9LN631e-174BZR2_ARATH; Protein BRASSINAZOLE-RESISTANT 2
TrEMBLF4HP451e-172F4HP45_ARATH; Protein brassinazole-resistant 2
TrEMBLR0GQL61e-172R0GQL6_9BRAS; Uncharacterized protein (Fragment)
STRINGAT1G19350.31e-172(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24722772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.31e-150BES1 family protein